PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Pavir.7NG021200.1.p
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; PACMAD clade; Panicoideae; Panicodae; Paniceae; Panicinae; Panicum
Family B3
Protein Properties Length: 434aa    MW: 48296.3 Da    PI: 8.2818
Description B3 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Pavir.7NG021200.1.pgenomeJGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1B333.29.1e-11401191499
                          T-EE--HHH.HTT---..--SEEEEEETTS...-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-SSSEE..EEEEE-S CS
                   B3  14 grlvlpkkfaeehggkkeesktltledesg...rsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldgrsefelvvkvfrk 99 
                          + l++p + ae +g       + ++  +sg   ++W+v++   + +++ +l++GW eF+ a g+ +g f+v+ ++g  ++ l++k+f++
  Pavir.7NG021200.1.p  40 DSLRIPDELAEGIGAG-----EARVVGPSGgkvKVWRVEV--GRDGDGAFLGRGWAEFAAACGVGAGWFLVLWHHG--GGVLTFKAFDA 119
                          67999*****999755.....68999999999********..999999*************************655..77779998886 PP

2B351.51.8e-16302380686
                          ..-HHHHTT-EE--HHH.HTT---..--SEEEEEETTS-EEEEEE..EEETTEEEE-TTHHHHHHHHT--TT-EEEEEE-S CS
                   B3   6 tpsdvlksgrlvlpkkfaeehggkkeesktltledesgrsWevkliyrkksgryvltkGWkeFvkangLkegDfvvFkldg 86 
                          ++ ++l+++ l+l+k+f++++g+ +++ +tl+   +s +sW+v+   +k+  ++v+ +GW  F++an LkegD+++F +++
  Pavir.7NG021200.1.p 302 INTNTLRNK-LSLSKSFCDAIGLREPCIVTLKTSMSSTESWQVNGFPCKNN-SFVILRGWMMFCRANSLKEGDICTFNVVE 380
                          555566665.**************99988888888999*******545554.577777*******************9654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS508638.27527120IPR003340B3 DNA binding domain
SMARTSM010194.8E-430120IPR003340B3 DNA binding domain
PfamPF023622.5E-838119IPR003340B3 DNA binding domain
CDDcd100177.35E-938118No hitNo description
SuperFamilySSF1019366.47E-1138122IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.102.4E-1040122IPR015300DNA-binding pseudobarrel domain
Gene3DG3DSA:2.40.330.101.0E-12141248IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086310.095150246IPR003340B3 DNA binding domain
SMARTSM010190.0013154246IPR003340B3 DNA binding domain
SuperFamilySSF1019365.3E-13163248IPR015300DNA-binding pseudobarrel domain
CDDcd100177.33E-8165243No hitNo description
SuperFamilySSF1019369.42E-17292392IPR015300DNA-binding pseudobarrel domain
PROSITE profilePS5086311.561296392IPR003340B3 DNA binding domain
SMARTSM010191.4E-4298392IPR003340B3 DNA binding domain
Gene3DG3DSA:2.40.330.101.5E-17299391IPR015300DNA-binding pseudobarrel domain
PfamPF023625.1E-13306388IPR003340B3 DNA binding domain
CDDcd100174.01E-12308376No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 434 aa     Download sequence    Send to blast
MAPESQLEAH SHLRPSSLGT PDQVAANAKH LRVLLPFSCD SLRIPDELAE GIGAGEARVV  60
GPSGGKVKVW RVEVGRDGDG AFLGRGWAEF AAACGVGAGW FLVLWHHGGG VLTFKAFDAN  120
GCIRDPGSPT AEATASRKDA AHRPQFVSVL PQDFKENMIH TLLLLLIPAM FVQHYIPEEH  180
RNNRLAVVIG SRGKIYHVDL ELNQSDMFFR GGWSQFLASD GITQANDLLL RYEGNMVFTV  240
KVFGPDGCQR EPKHKDIRIQ QDTGKQQEAP SEPIKSFERA RRIGQRTAVY EVGPPSWIMK  300
EINTNTLRNK LSLSKSFCDA IGLREPCIVT LKTSMSSTES WQVNGFPCKN NSFVILRGWM  360
MFCRANSLKE GDICTFNVVE TTLWHVVITR YNKEKVNRLC YPVHLDIERD SNHLSIWHGL  420
WNISPGLILR ANV*
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankAC2432583e-44AC243258.1 Panicum virgatum clone PV_ABa103-H10, complete sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_004975298.11e-145PREDICTED: putative B3 domain-containing protein Os04g0347400 isoform X1
SwissprotQ7XS742e-90Y4474_ORYSJ; Putative B3 domain-containing protein Os04g0347400
TrEMBLA0A0A9S1931e-170A0A0A9S193_ARUDO; Uncharacterized protein
STRINGSi012530m1e-129(Setaria italica)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MonocotsOGMP42535187
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G24700.12e-13B3 family protein